SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EPY50164 from Schizosaccharomyces cryophilus OY26 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPY50164
Domain Number 1 Region: 7-155
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.5e-25
Family NQO2-like 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EPY50164
Sequence length 158
Comment pep:novel supercontig:GCA_000004155.2:supercont4.6:109510:112877:-1 gene:SPOG_00926 transcript:EPY50164 description:"eukaryotic protein"
Sequence
MKPTRFFTPENLQIVKRIISRYPSGQERASLVPLLDLAQRQNGTWIPPSAMQEIANSTGL
SFEQVHSFILGYPTSFEWRPCAPQLRICNSWMCCHKAKQQDYDIFEAARSVAQPYGVEVK
TTGCLGACYGAPAFWFNDKIHTDATKEFIKQVISKELS
Download sequence
Identical sequences S9VVH1
XP_013024651.1.62511 EPY50164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]