SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EPY50433 from Schizosaccharomyces cryophilus OY26 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPY50433
Domain Number 1 Region: 10-95
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.8e-25
Family Glutathione S-transferase (GST), N-terminal domain 0.00035
Further Details:      
 
Domain Number 2 Region: 86-225
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.37e-18
Family Glutathione S-transferase (GST), C-terminal domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EPY50433
Sequence length 230
Comment pep:novel supercontig:GCA_000004155.2:supercont4.6:726298:727014:1 gene:SPOG_01190 transcript:EPY50433 description:"glutathione S-transferase Gst2"
Sequence
MYSSNILRKIAQFTLFSHKGSPNPWKVALTLKELNLSYEPVYYDFGKKEQKCKEHLAYNP
NGRVPTLVDHKNNDIAIWESDAILAYLTDRYDKERKISLPHDHPEYHHLLQYLFFQSSGQ
GVIWGQASWFNFYHPEPVTSAITRYRNETKRVLDRDYLVANKCTIADLSFVTWNDLLPAI
FGPGKNEFKEELPQLDFEKEFPKTHEWHKRLIERPAVSTALREREELLKQ
Download sequence
Identical sequences S9VR66
EPY50433 XP_013024916.1.62511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]