SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EPY51362 from Schizosaccharomyces cryophilus OY26 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPY51362
Domain Number 1 Region: 280-423
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000093
Family UBX domain 0.019
Further Details:      
 
Domain Number 2 Region: 101-213
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000134
Family Thioltransferase 0.044
Further Details:      
 
Weak hits

Sequence:  EPY51362
Domain Number - Region: 4-48
Classification Level Classification E-value
Superfamily UBA-like 0.000284
Family UBA domain 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EPY51362
Sequence length 427
Comment pep:novel supercontig:GCA_000004155.2:supercont4.4:732827:734742:1 gene:SPOG_02535 transcript:EPY51362 description:"UBA/UAS domain-containing protein Ucp10"
Sequence
MSRSGEQEAIQALQSSLDVPVDTAQSVLESFNWNVQEAVEFLTGESSQESRKKKPLPGFG
FFHSIFSFIFSGFYKFWMFLSRVPLLPTFLPILGARKRYLSPADAANKLLQNLEEQYGTN
HIDFFTEGGYMEALARTKRSFGVALLFFTSTKSDDMEDFSKKVLMDEEVKGFLSRRNILC
WVGDVCEDEAFQGSRQFNCTKFPSAVLIMYSPQLSELVVAAHLHGPMDSTLLQNTLTNAL
ARHLPSLERFRTERESRESTRELRRQQDDAYQASLARDRERQKQAKEERERKQKEQEEKE
RMLKLSLQYRSWLAVSIPSEPQPNTQAARLSIRLPDGTRVIRRFEKDCLVKSIYEFVDSL
LFAKEEPEVYEQAMSSSAVLAPPENYQHKFHFSLYSSLPREILEMESTICDLPSVFPSGT
VVVELED
Download sequence
Identical sequences S9X2Q4
XP_013023931.1.62511 EPY51362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]