SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EPY51408 from Schizosaccharomyces cryophilus OY26 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPY51408
Domain Number 1 Region: 6-107
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000127
Family YKR049C-like 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EPY51408
Sequence length 121
Comment pep:novel supercontig:GCA_000004155.2:supercont4.4:835231:835596:-1 gene:SPOG_02579 transcript:EPY51408 description:"electron carrier"
Sequence
MFGLTTKRILTLFARKRNTVIEEKLTEYMILGERTNNEQFRYQLQVELDPPTQDQISIML
SNIQKDQSHLLISGATSVQDALNKYQNDFRTFRRPCLVDWDKGKVSPYSLLLQTRDFKQL
L
Download sequence
Identical sequences S9VUF4
XP_013023975.1.62511 EPY51408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]