SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EPY52013 from Schizosaccharomyces cryophilus OY26 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPY52013
Domain Number 1 Region: 58-148
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.01e-18
Family Thioltransferase 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EPY52013
Sequence length 162
Comment pep:novel supercontig:GCA_000004155.2:supercont4.3:949878:950399:-1 gene:SPOG_00433 transcript:EPY52013 description:"monothiol glutaredoxin Grx3"
Sequence
MLNPKVILCVSILITLFIPLTKNSSSPLAAQSHPSSSSFKIKLPSKDAKEEKDFQVFLEN
PVMVFSRPGCPYSSAAKSMLTETLTTEPAPVIVEVTEFTYINELRSWLSSVSDVSTLPNI
FFGGHSIGGYDDLQKLYRENEVQGELDRWTYNQVKVVPIQQA
Download sequence
Identical sequences S9VWI5
XP_013023396.1.62511 EPY52013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]