SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EPY52192 from Schizosaccharomyces cryophilus OY26 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPY52192
Domain Number 1 Region: 21-105
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.27e-18
Family Mitochondrial ribosomal protein L51/S25/CI-B8 domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EPY52192
Sequence length 142
Comment pep:novel supercontig:GCA_000004155.2:supercont4.3:1329369:1330823:-1 gene:SPOG_04849 transcript:EPY52192 description:"ribosomal protein subunit L51"
Sequence
MIEIVQKTAIPKNGLGSFIRPCQRIELSYCNWGGSSKSMKEFLSKKLAAIAKTSQDIEFH
VYNQQGKHPLIRAFYNTGREKTICTRKMDANQITDKIMLCRDSDGLKPRFIKQPVESTNP
SVRGVWSPFSETAESYRVYGKN
Download sequence
Identical sequences S9X529
XP_013023575.1.62511 EPY52192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]