SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EPY52286 from Schizosaccharomyces cryophilus OY26 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPY52286
Domain Number 1 Region: 84-190
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 5.29e-22
Family Glutathione S-transferase (GST), C-terminal domain 0.0081
Further Details:      
 
Domain Number 2 Region: 1-76
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000764
Family Glutathione S-transferase (GST), N-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EPY52286
Sequence length 229
Comment pep:novel supercontig:GCA_000004155.2:supercont4.2:177447:178186:1 gene:SPOG_01621 transcript:EPY52286 description:"glutathione S-transferase domain-containing protein"
Sequence
MAFGTVYGSVKSPRVGMVLSTAALLGLPVENASNTLPGSFPKGLAEKFPIQKIPVFVGAD
GICLWQSIAIASFFASYDPLGIVGGATALAKAEVLMWACFFNQEFYDAVIPWVAGRMRSI
PYDPKTEEKAKKNTFSIFAVLERQVKDKEFLVGEDPTIADAAAVASLYFVLSSVMTKDEL
AKFPEIQRYYINAYPKLKFDQLCGPLQLLSEPVPIPKAPPSPILTCDEL
Download sequence
Identical sequences S9XET4
EPY52286 XP_013022178.1.62511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]