SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EPY52430 from Schizosaccharomyces cryophilus OY26 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPY52430
Domain Number 1 Region: 2-101
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.5e-32
Family Thioltransferase 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EPY52430
Sequence length 103
Comment pep:novel supercontig:GCA_000004155.2:supercont4.2:491923:492557:1 gene:SPOG_01755 transcript:EPY52430 description:"cytosolic thioredoxin Trx1"
Sequence
MVNQISKTEDFKAVIAQDKLVVVDFFATWCGPCKAIAPKVEQFSKTYSNAEFIKVDVDEL
SEIAAEAGVHAMPSFFLYKKGQKVAEVVGANPAKLEAVIKENL
Download sequence
Identical sequences S9W3A9
EPY52430 XP_013022313.1.62511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]