SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EPY53188 from Schizosaccharomyces cryophilus OY26 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPY53188
Domain Number 1 Region: 36-141
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.44e-32
Family Thioltransferase 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EPY53188
Sequence length 152
Comment pep:novel supercontig:GCA_000004155.2:supercont4.1:339142:340047:1 gene:SPOG_03726 transcript:EPY53188 description:"monothiol glutaredoxin Grx5"
Sequence
MAATLFNQNKHLKTVNMFRNSFKLFGNQIRNLSTQTRQALEQAVKEDPVVLFMKGTPNQP
MCGFSLRSIQVLSLENVATDKLATYNVLSNEELRDGIKEFSDWPTIPQLYINGEFVGGCD
ILMSLHKSGELHKMLKEINALAPTKPEGDVAN
Download sequence
Identical sequences S9VZR9
EPY53188 XP_013021444.1.62511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]