SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EPY53366 from Schizosaccharomyces cryophilus OY26 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPY53366
Domain Number 1 Region: 70-191
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 5.43e-17
Family Glutathione S-transferase (GST), C-terminal domain 0.011
Further Details:      
 
Domain Number 2 Region: 2-60
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000716
Family Glutathione S-transferase (GST), N-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EPY53366
Sequence length 226
Comment pep:novel supercontig:GCA_000004155.2:supercont4.1:729687:730415:-1 gene:SPOG_03893 transcript:EPY53366 description:"glutathione S-transferase Gst3"
Sequence
MIILHHLADSRSSRIIWLLEEMKVPYKLKHYDRKSPALEDNGKTYIESAAVIEHLVRKYK
RDLKPSEDNLDALEKYEFWMHYAEGSLMMLVVGLFVNNKAVDMSPLVSRFLVRKVTNTIN
ENYYLKELFLNLEHVDDFLSTSKFVTGDHFTAADVQMSYPLLCLQSTVLKSRPYTNIKRW
LIEVTSRPAFEVASHKAHDKVFQLLNETTQGKDEEIADFSSFSISA
Download sequence
Identical sequences S9XI87
XP_013021611.1.62511 EPY53366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]