SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EPY54232 from Schizosaccharomyces cryophilus OY26 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPY54232
Domain Number 1 Region: 26-135
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.26e-30
Family Thioltransferase 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EPY54232
Sequence length 138
Comment pep:novel supercontig:GCA_000004155.2:supercont4.1:2660017:2660695:1 gene:SPOG_04125 transcript:EPY54232 description:"thioredoxin Trx2"
Sequence
MNSLCRVARGFRPMSFAKSGLLNRTFMSSSVLKEVQHVKSMQDYTRLVNDDKVSVVDFYA
DWCGPCKFLSPLLEKLSNSHSKSSFIAVDADKFSELAQKNEVYALPTVVLFKKGQELDRI
VGADIRAINGLLAKYETS
Download sequence
Identical sequences S9XAQ0
XP_013021841.1.62511 EPY54232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]