SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Agabi_varbisH97_2|201003|estExt_Genewise1Plus.C_30359 from Agaricus bisporus var. bisporus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Agabi_varbisH97_2|201003|estExt_Genewise1Plus.C_30359
Domain Number 1 Region: 30-81,112-208
Classification Level Classification E-value
Superfamily PH domain-like 4.46e-32
Family Pleckstrin-homology domain (PH domain) 0.0022
Further Details:      
 
Domain Number 2 Region: 302-366,407-452
Classification Level Classification E-value
Superfamily PH domain-like 1.42e-24
Family Pleckstrin-homology domain (PH domain) 0.0084
Further Details:      
 
Weak hits

Sequence:  jgi|Agabi_varbisH97_2|201003|estExt_Genewise1Plus.C_30359
Domain Number - Region: 269-278
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0549
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Agabi_varbisH97_2|201003|estExt_Genewise1Plus.C_30359
Sequence length 506
Sequence
MSPSAAPPTPLEVQRKLSVHSATHPIKVSPSMPFLNTTVSGTESDSDSILTPDVGISSSH
TPGGAAVSHTIPPPLSSIAEQSPGSGAEDSDEEEEEGGWQMGEDVAAKTPRGVDTTIKSG
YLAKKGARRKTWKKRWFVLRPSHLAFYKTEAEYKLLRLLDLADVHSCTPVHLKRHDNAFG
LILPKRTYYLQAGSAKDAQAWVEAIEEARVTLMTTSTQTSTNSNAIPIPGAARTSFFHGS
VPISSSPQNMDHVNSSDSEDALSVGAPSPPSPPPPPPPMVSSSPGVEGQRGNMQNVTFSV
SPSKPSPPVILSGYLMKCGSKRRNWRKRWFVLSSDKLIYSRSHMDIKPHRMFTLNDILDA
MDYDMPVHRHHHHHHPNVLAPSVSSTPSHGNSGGYTTGGTSDLSDSQRKNFTFKIVMTKR
NLLLCAPSEEDEIKWLGAVRALIARRAGSGQQQQPIPAATGMARAESSGGVKSPTKRLSV
GTAMVAGGGGKSTPSPDEEVRDGHGH
Download sequence
Identical sequences jgi|Agabi_varbisH97_2|201003|estExt_Genewise1Plus.C_30359 XP_006459069.1.82868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]