SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|375262335|ref|YP_005024565.1| from Vibrio sp. EJY3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|375262335|ref|YP_005024565.1|
Domain Number - Region: 2-39
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00129
Family Thioltransferase 0.066
Further Details:      
 
Domain Number - Region: 54-117
Classification Level Classification E-value
Superfamily FAH 0.0513
Family FAH 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|375262335|ref|YP_005024565.1|
Sequence length 128
Comment hypothetical protein VEJY3_15851 [Vibrio sp. EJY3]
Sequence
MAKLTIFYDGTCPLCAKEMRALTKRDTHQHIRIVDIYSEAFSAYPQIDAAKANTILHALD
DCGNLMLGLDVTYRAWQLVGRGWLYAPLRWPLIRPVADWLYIKFANNRYRISYWLTGTSR
CGTDQCSR
Download sequence
Identical sequences H2IIW2
gi|375262335|ref|YP_005024565.1| WP_014233436.1.13071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]