SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|375262632|ref|YP_005024862.1| from Vibrio sp. EJY3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|375262632|ref|YP_005024862.1|
Domain Number 1 Region: 1-156
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.48e-34
Family Glutathione peroxidase-like 0.000044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|375262632|ref|YP_005024862.1|
Sequence length 157
Comment antioxidant [Vibrio sp. EJY3]
Sequence
MIQQGQALPSATVSELTADGMANHDVTELFANKKVVLFAVPGAFTPTCSEAHLPGYVVLA
DQLKAKGVDLIACIATNDAFVMHAWGEAQNASEIMMLGDGDASFTKALGLEMDTGGFGGI
RSQRYAMIVDNGVVTKLNVEEPQKFEVSNAETILAAL
Download sequence
Identical sequences A0A1B1EH97 H2IJZ0
gi|375262632|ref|YP_005024862.1| WP_014233732.1.13071 WP_014233732.1.14200 WP_014233732.1.16983 WP_014233732.1.18931 WP_014233732.1.37005 WP_014233732.1.50333 WP_014233732.1.59672 WP_014233732.1.84506 WP_014233732.1.88247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]