SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|375263210|ref|YP_005025440.1| from Vibrio sp. EJY3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|375263210|ref|YP_005025440.1|
Domain Number 1 Region: 82-203
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3.9e-24
Family Glutathione S-transferase (GST), C-terminal domain 0.0067
Further Details:      
 
Domain Number 2 Region: 1-87
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.66e-19
Family Glutathione S-transferase (GST), N-terminal domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|375263210|ref|YP_005025440.1|
Sequence length 204
Comment glutathione S-transferase domain-containing protein [Vibrio sp. EJY3]
Sequence
MKLYETAMTPSCKRVNIFLKEIGGDVERVAINVRDGDNLTDSFKQKSVNGKVPVLEFDDG
TTICESVAICRYFDEEFSNDLNLFGGNQRERAQVEMWHRVVEFQGLYAAFQAFRNISAIY
KDRENCVKEWGEESKSRVLEFLPVLDKRLAESEFIATDRFTIVDITGYLFVGFAINALQI
DVLSTAPNIARWFEKISAREAFQS
Download sequence
Identical sequences A0A1B1EKP3 H2ILR4
WP_014234309.1.13071 WP_014234309.1.88247 gi|375263210|ref|YP_005025440.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]