SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|375263619|ref|YP_005025849.1| from Vibrio sp. EJY3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|375263619|ref|YP_005025849.1|
Domain Number 1 Region: 2-76
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.94e-20
Family Thioltransferase 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|375263619|ref|YP_005025849.1|
Sequence length 78
Comment thiol-disulfide isomerase/thioredoxin [Vibrio sp. EJY3]
Sequence
MKIFKVLGSGCANCVNTANLIEKIAAEQGVEVEVEKVTDMETIMNYGVMSTPAVVMDEEL
VHSGGVPQADKIQSWLTS
Download sequence
Identical sequences A0A1B1EJL2 H2IJ48
gi|375263619|ref|YP_005025849.1| WP_014234714.1.13071 WP_014234714.1.16983 WP_014234714.1.88247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]