SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|375263934|ref|YP_005026164.1| from Vibrio sp. EJY3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|375263934|ref|YP_005026164.1|
Domain Number 1 Region: 2-85
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.74e-16
Family Glutathione S-transferase (GST), N-terminal domain 0.0095
Further Details:      
 
Domain Number 2 Region: 83-199
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.000000000000316
Family Glutathione S-transferase (GST), C-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|375263934|ref|YP_005026164.1|
Sequence length 215
Comment glutathione S-transferase [Vibrio sp. EJY3]
Sequence
MKLYIGNQNYSSWSLRAWLIFMQYDIDVEIEKIKLFTDEFYNTLEDITPTAKVPTLVCND
VTVWDSLAILEYVNEAFLDDKAWPQSLTERAKARAISAEMHSGFMALRNEMPMNCRAKRS
VALSKDALKDIERIDQIWSLQMEQYPDGWLFGEWSIADAMYAPVVLRTLTYGIKLSEKAT
QYQQKVLNSDTMQRWLTEASLETDIVEEDEAGEPI
Download sequence
Identical sequences H2IN80
WP_014235025.1.13071 gi|375263934|ref|YP_005026164.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]