SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|375264003|ref|YP_005026233.1| from Vibrio sp. EJY3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|375264003|ref|YP_005026233.1|
Domain Number 1 Region: 201-516
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.89e-50
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00000954
Further Details:      
 
Domain Number 2 Region: 1-101
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.62e-26
Family PDI-like 0.00027
Further Details:      
 
Domain Number 3 Region: 104-196
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.42e-23
Family PDI-like 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|375264003|ref|YP_005026233.1|
Sequence length 530
Comment alkyl hydroperoxide reductase subunit F [Vibrio sp. EJY3]
Sequence
MLDQAIQQQLKQYLANVKEDVRLVVSLDESKAANDILSLANQIAEMSEHISVVRDDAASD
RKPVMAVTNPTKGTALSFAGLPMGHEFTSLVLALLHSGGHPIKLEPEVIEQIAALDKELD
VEIFISLSCQNCPDVVQAFNMMAAINPKVKTTMIDGALFQDEVKHRDIMAVPSVFVNGEL
FGQGRMSLTEILNKVDDSASEKAAKALDEKEPYDVLVVGGGPGGSAAALYAARKGIRTGV
VAKRFGGQVMDTMAIENFVSVKRTEGPKLAADLGEHLKEYDVDVVTEQQAKKLMGAAHTE
DGLIHIQLESGATLKSQSVILSPGARWREMNVPGEQEYRNKGVAYCPHCDGPLFKGKKTA
VIGGGNSGIEAAIDLAGIVEHVTVLEFADVLRADQVLINKANSLPNVDIITMAQTTEVVG
DGKRVTGLKYKDRNTDEIKELELSGIFVQIGLVPNTEWLKDSDVNLSPRGEIEVGSHGET
SLEGVFAAGDATTVPYKQIIIAMGEGAKASLGAFDYLIRKQGLSPELLEQ
Download sequence
Identical sequences H2INE9
gi|375264003|ref|YP_005026233.1| WP_014235094.1.13071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]