SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|375264430|ref|YP_005021873.1| from Vibrio sp. EJY3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|375264430|ref|YP_005021873.1|
Domain Number 1 Region: 82-208
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.99e-23
Family Glutathione S-transferase (GST), C-terminal domain 0.0091
Further Details:      
 
Domain Number 2 Region: 11-110
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.98e-22
Family Glutathione S-transferase (GST), N-terminal domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|375264430|ref|YP_005021873.1|
Sequence length 211
Comment stringent starvation protein A [Vibrio sp. EJY3]
Sequence
MAVAANKRSVMTLFSSASDLYSHQVRIVLAEKGVSVEVELVDEANLPAELIELNPYKSVP
TLVDRELALYDSKIIMEYLDERFPHPPLMPVYPVARGNSRLMMYRIERNWYSLAEKVMKG
NAEESEKARTKLRNDLLTLAPIFAEYEYFMSEEFSLIDCYLAPLLWRLPQLGIELVGPGS
KEIKVYMNRVFERDSFLASLTEAEREMRLVR
Download sequence
Identical sequences A0A1B1E9I7 H2IDU6
gi|375264430|ref|YP_005021873.1| WP_014230786.1.13071 WP_014230786.1.14200 WP_014230786.1.16983 WP_014230786.1.18931 WP_014230786.1.37005 WP_014230786.1.50333 WP_014230786.1.59672 WP_014230786.1.84506 WP_014230786.1.88247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]