SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|375266096|ref|YP_005023539.1| from Vibrio sp. EJY3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|375266096|ref|YP_005023539.1|
Domain Number 1 Region: 41-166
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.14e-24
Family Glutathione peroxidase-like 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|375266096|ref|YP_005023539.1|
Sequence length 171
Comment hypothetical protein VEJY3_10405 [Vibrio sp. EJY3]
Sequence
MSSKSRRKSWQHWLRQLLQIVIIVTVVSVGIDWYRTKDIPKQNAPALSAFMSSGQYVDVI
EKSHEEPVVVYFWATWCPACKFVSPSVNWISDHYSVIGVSGSSGNEERVKQFMMSKDYRF
NNINDPKSKIMQDWKVVVTPTIYVLRNGEITSITTGISTPMGILARIWLAS
Download sequence
Identical sequences H2IGY1
WP_014232436.1.13071 gi|375266096|ref|YP_005023539.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]