SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|375266298|ref|YP_005023741.1| from Vibrio sp. EJY3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|375266298|ref|YP_005023741.1|
Domain Number 1 Region: 46-178
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.77e-38
Family Glutathione peroxidase-like 0.0000069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|375266298|ref|YP_005023741.1|
Sequence length 184
Comment thiol:disulfide interchange protein DsbE [Vibrio sp. EJY3]
Sequence
MNKKVLFIPLVAFMVLAGIFATQLMRNQEGDDPTKLESVLVGKPVPAFHLEDLAEPGKEY
DQSIFKGEPLLLNVWATWCPTCYAEHKYLNELAGKGVKIIGMNYKDDRTKAVGWLNDLGN
PYLISLFDGSGMLGLDLGVYGAPETFIIDASGVVRYRHVGDVNPRNWADTLEPLYNQLVE
EAKL
Download sequence
Identical sequences H2II71
WP_014232637.1.13071 WP_014232637.1.84506 gi|375266298|ref|YP_005023741.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]