SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|375266348|ref|YP_005023791.1| from Vibrio sp. EJY3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|375266348|ref|YP_005023791.1|
Domain Number 1 Region: 2-114
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.76e-35
Family ArsC-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|375266348|ref|YP_005023791.1|
Sequence length 116
Comment hypothetical protein VEJY3_11670 [Vibrio sp. EJY3]
Sequence
MTITMFGIPNCDTIKKAKKWLEAEDIAYEFHDYRKQGVDEALVTEFCDALGWEIVLNKRG
TTFRQLTQEQKDSLNEENAIKLLVENPAMIKRPILKVNDQFHIGFKADQYTTIFNS
Download sequence
Identical sequences H2IIC1
WP_014232686.1.13071 gi|375266348|ref|YP_005023791.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]