SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|375266384|ref|YP_005023827.1| from Vibrio sp. EJY3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|375266384|ref|YP_005023827.1|
Domain Number - Region: 5-43
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000187
Family Glutathione peroxidase-like 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|375266384|ref|YP_005023827.1|
Sequence length 45
Comment thioredoxin-dependent thiol peroxidase, partial [Vibrio sp. EJY3]
Sequence
MGKIYDGLHRISFLINEEGVIEHVFNKFKTKDHHEVVLNYLNENA
Download sequence
Identical sequences H2IIN8
WP_014232722.1.13071 WP_014232722.1.84506 WP_014232722.1.88247 gi|375266384|ref|YP_005023827.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]