SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|375266923|ref|YP_005024366.1| from Vibrio sp. EJY3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|375266923|ref|YP_005024366.1|
Domain Number 1 Region: 39-152
Classification Level Classification E-value
Superfamily Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) 1.7e-39
Family Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) 0.0000411
Further Details:      
 
Domain Number 2 Region: 501-604
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.55e-22
Family Thioltransferase 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|375266923|ref|YP_005024366.1|
Sequence length 606
Comment thiol:disulfide interchange protein [Vibrio sp. EJY3]
Sequence
MRALLSVLLLGLITFSAPSLALFGKDQFNNSQNNNFGNSSDSFVPVDQAFPFNFYQQDDK
LMLDWQVRDGYYLYQERLSVSGENVTLGELDMERGTPHKDEFFGEVHIYTMPLFVNVPLS
NWQEGARVIVQYQGCASAGFCYPPETRVIPINAFTSPTGSAATTAPQQPTQKQTTQATPK
VTNTAPTAPVTQQDSLAANLAESWWTPLLFLALGVGLAFTPCVLPMYPILTSIVLGSGKL
SQRRALGLSFIYVQGMALTYTLLGLVVASAGMQFQAAMQHPYVLIGLSVLFIALAMSMFG
LYSLQLPSSVQTWLNNLSNKQHGGSGTGVFVMGAISGLVCSPCTTAPLSGALLYVAQSGD
LLTGGVALYALAMGMGIPLILVAVFGNKLLPKAGNWMGRVKTLFGFILLAAPIFLLERLL
PEMWSTLLWSVLGVAAFGWLYHVKNSLEFGGWKQSAVGIIAVLGLFASAQPALNYWFGNN
ETHAQQASVSFTRIANVAELEEQLALAKAAGKPVMLDFYADWCVACKEFEKYTFHSPKVE
EKLRDFVLLQADVTKNQVQDIELLKRMNVLGLPTIEFWNSKGEHVSNARLTGFMQAEPFL
EHINQF
Download sequence
Identical sequences H2IE97
WP_014233247.1.13071 gi|375266923|ref|YP_005024366.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]