SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|375265309|ref|YP_005022752.1| from Vibrio sp. EJY3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|375265309|ref|YP_005022752.1|
Domain Number 1 Region: 2-71
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000619
Family Thioltransferase 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|375265309|ref|YP_005022752.1|
Sequence length 76
Comment glutaredoxin [Vibrio sp. EJY3]
Sequence
MKRVVLYVKDKCPHCKDAQRYLDSKNITYRLCNAKMQRGRKELDALGARSLPVLKIGDQL
MIGWNPKNFEKMYKGD
Download sequence
Identical sequences A0A1B1ECH5 H2IAT5
gi|375265309|ref|YP_005022752.1| WP_014231652.1.13071 WP_014231652.1.14200 WP_014231652.1.16983 WP_014231652.1.18931 WP_014231652.1.37005 WP_014231652.1.50333 WP_014231652.1.59672 WP_014231652.1.84506 WP_014231652.1.88247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]