SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|375266361|ref|YP_005023804.1| from Vibrio sp. EJY3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|375266361|ref|YP_005023804.1|
Domain Number 1 Region: 3-153
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.09e-47
Family Glutathione peroxidase-like 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|375266361|ref|YP_005023804.1|
Sequence length 154
Comment redoxin domain-containing protein [Vibrio sp. EJY3]
Sequence
MTIEAGQTAPDFTLNDQDNNPVTLSELQGKKVLLYFYPRASTPGCTVQAQGLRDTKAELD
THNVVVLGISPDTPKKLTNFINKQELNFTLLSDEEHEVCEKYGVWQLKKFMGRENMGVVR
TSFLIDESGNLEHVFNKFKTKDHHEVVLDYLNNK
Download sequence
Identical sequences H2IID4
gi|375266361|ref|YP_005023804.1| WP_014232699.1.13071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]