SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|375266388|ref|YP_005023831.1| from Vibrio sp. EJY3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|375266388|ref|YP_005023831.1|
Domain Number 1 Region: 2-116
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.28e-35
Family ArsC-like 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|375266388|ref|YP_005023831.1|
Sequence length 116
Comment arsenate reductase [Vibrio sp. EJY3]
Sequence
MSVVIYHNPRCSKSRQTLELLEQNGVTPEVVKYLDNPLTVEELKALYAQLGFSAVRDMMR
TKEAEYKELGLGEASVSDEQLFEAMAQNPKLFERPVVVANGKAKIGRPPEQVLDIL
Download sequence
Identical sequences A0A1B1EE56 H2IIP2
WP_014232726.1.13071 WP_014232726.1.14200 WP_014232726.1.16983 WP_014232726.1.18931 WP_014232726.1.37005 WP_014232726.1.50333 WP_014232726.1.59672 WP_014232726.1.84506 WP_014232726.1.88247 gi|375266388|ref|YP_005023831.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]