SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|375267082|ref|YP_005024525.1| from Vibrio sp. EJY3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|375267082|ref|YP_005024525.1|
Domain Number 1 Region: 21-197
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.07e-44
Family DsbA-like 0.000000167
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|375267082|ref|YP_005024525.1|
Sequence length 200
Comment periplasmic thiol:disulfide interchange protein DsbA [Vibrio sp. EJY3]
Sequence
MKKLFALFSMLMLSLSAQAAQFNEGEHYKVLDLEASNKPVVTEFFSFYCPHCNSFEPIIQ
QLKKQLPEGVKLQKNHVSFMGGSMGPSMSKAFATMVALKVEDKMVPVMFNRIHNLRKAPR
DDAELRQIFLDEGVDEKKFDSAFKGFAVDSMVRRMDKQFEDSGLTGVPAVIVNNKYLVQA
QSIKTMDEYFALVNYLLELK
Download sequence
Identical sequences H2IFM1
gi|375267082|ref|YP_005024525.1| WP_014233398.1.13071 WP_014233398.1.14200 WP_014233398.1.18931 WP_014233398.1.37005 WP_014233398.1.50333 WP_014233398.1.59672 WP_014233398.1.84506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]