SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Aspca1|10409|e_gw1.00042.384.1 from Aspergillus carbonarius ITEM 5010

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspca1|10409|e_gw1.00042.384.1
Domain Number 1 Region: 86-203
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.78e-20
Family Glutathione S-transferase (GST), C-terminal domain 0.0069
Further Details:      
 
Domain Number 2 Region: 2-76
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000302
Family Glutathione S-transferase (GST), N-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspca1|10409|e_gw1.00042.384.1
Sequence length 213
Sequence
MLIIHHLQRSQSERIIWLCEELQLPYELKIYQRSPLLAPPELQALHPSQTAPIIQDGPIT
LAESGAIFEYILTKHNPSHKLTLSPDHPSYPEYLYFLHFANGTFQPAILRYGLVTRVGLH
LQEENFSAQLALRSFSRALKILDERLRENKWLAGEEFSAADVMIVVCLTTVRGWIPYELE
EYVGIKEYLGRVGEREGFRRMRERGDPDMVDTM
Download sequence
Identical sequences A0A1R3RM24
jgi|Aspca1|10409|e_gw1.00042.384.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]