SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Aspca1|12986|e_gw1.00129.400.1 from Aspergillus carbonarius ITEM 5010

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspca1|12986|e_gw1.00129.400.1
Domain Number 1 Region: 20-130
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.58e-36
Family PDI-like 0.0073
Further Details:      
 
Domain Number 2 Region: 139-251
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.15e-31
Family PDI-like 0.0061
Further Details:      
 
Domain Number 3 Region: 263-355
Classification Level Classification E-value
Superfamily ERP29 C domain-like 1.24e-19
Family ERP29 C domain-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspca1|12986|e_gw1.00129.400.1
Sequence length 357
Sequence
MVRLNHLLASCLSLASAVTAVVDLVPTNFDDVVLKSGKPALVEFFAPWCGHCKNLAPVYE
ELGQVFAHASDKVSVAKVDADENRDLGRRFGVQGFPTLKWFDGKSDTPEDYKGGRDLESL
SAFITEKTGVKPRGPKKEPSKVEMLTDATFKSVVNGDKDVLVAFTAPWCGHCKNLAPTWE
LLANDFALEDDVVIAKVDADAETGKATAREQGVSGYPTIKFFPKGSTESVSYEGARSQQA
FIDYLNEKAGTHRTIGGGLDAKAGTIASLDELIVSSPADLAAALKEAAADLKDKYAQYYV
KVADKLSQNAEYVSKELARLEKILAKGGSAPEKVDDLVSRSNILRQFVGEKEVKDEL
Download sequence
Identical sequences A0A1R3RSP0
jgi|Aspca1|12986|e_gw1.00129.400.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]