SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Aspca1|13920|e_gw1.00162.168.1 from Aspergillus carbonarius ITEM 5010

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspca1|13920|e_gw1.00162.168.1
Domain Number 1 Region: 171-319
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 4.87e-22
Family Glutathione S-transferase (GST), C-terminal domain 0.022
Further Details:      
 
Domain Number 2 Region: 20-71,108-144
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000352
Family Glutathione S-transferase (GST), N-terminal domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspca1|13920|e_gw1.00162.168.1
Sequence length 337
Sequence
MAQIHTPGTADSWHGTIPSTTFPSTPNRYHLYIGLFCPFAHRVNFIRHLYNLTTIIPLSI
VRPYPKGDLKGWPGWKFPASDDEYPGATVDHLYGEEYLHKVYFRADPEYKGRYSVPLLWD
KVAGTAVCNESMQLLRWLPHAFNDYVPPSLAKIDLYPVHLREQIEAISPWLQSDVNSGVY
RAGFAESQEEYDEKVVRVFGALNKLERIIAANGGPFVLGKEMTELDVMLYATLIRFDVVY
VQHFKCNLGTIRHDYPVLHNWLKGMYWDVEAARATTNFKHIKENYTKSHWQVNPTAITPL
GPFPDIEEGVERDWSKLSVGGVKHPAVLEHEAGIPDV
Download sequence
Identical sequences A0A1R3RC59
jgi|Aspca1|13920|e_gw1.00162.168.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]