SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Aspca1|14395|e_gw1.00168.488.1 from Aspergillus carbonarius ITEM 5010

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspca1|14395|e_gw1.00168.488.1
Domain Number 1 Region: 3-83
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.23e-17
Family Glutathione S-transferase (GST), N-terminal domain 0.0013
Further Details:      
 
Domain Number 2 Region: 89-179
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.00000000000000376
Family Glutathione S-transferase (GST), C-terminal domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspca1|14395|e_gw1.00168.488.1
Sequence length 197
Sequence
MPLKPIKLYWRNHVPNPAKVLIILEELHLPYETSWVELEDLKQKPFTDVNPNGRVPAIID
PNTNITIWESGAIYLVDTYDKANKLTYTTLPEKYQLIQYSYFQASGQGPYFGQAAWFNLF
HQNIYGDSPESAKVRYGAEVKRIAGVLNTILSEREWLVGDKCTYADLAFAMWNLQIEFFM
SGRTGEEAWRTEEFPFF
Download sequence
Identical sequences jgi|Aspca1|14395|e_gw1.00168.488.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]