SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Aspca1|19511|fgenesh1_pm.00082_#_119 from Aspergillus carbonarius ITEM 5010

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspca1|19511|fgenesh1_pm.00082_#_119
Domain Number 1 Region: 21-129
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.1e-33
Family PDI-like 0.0006
Further Details:      
 
Domain Number 2 Region: 319-468
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.63e-29
Family PDI-like 0.0000646
Further Details:      
 
Domain Number 3 Region: 230-358
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.13e-26
Family PDI-like 0.00000953
Further Details:      
 
Domain Number 4 Region: 136-241
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.78e-23
Family PDI-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspca1|19511|fgenesh1_pm.00082_#_119
Sequence length 515
Sequence
MRSFAPWLVSLLGASAVVVAADTESDVISLSKDTFEDFMKEHDLVLAEFFAPWCGHCKAL
APKYEEAAKELKTKNIPLVKVDCTAEEDLCRDHGVEGYPTLKIFRGVDSSKPYQGARQTE
SIVSYMTKQSLPAVSSVNEENLEEIKAMDKIVVIGYIPSEDKETYQAFEKYAESQRDNYL
FAVTNDPAIAKAEGVDQPSLVLYKDFDEKKAVYKGEIEQETIHNWVKSASTPLVGEIGPE
TYSGYIGAGIPLAYIFAETQEEREKYTEDFKPIAQKHKGAINIATIDAKMFGAHAGNLNL
DPQTFPAFAIQDPAKNAKFPYDQSKQLDVDEVDKFIQDVIDGNVDPSIKSEPVPDTQEGP
VTVVVAHSYKELVLDNDKDVLVEFYAPWCGHCKALAPKYDELAGLYAENPDFATKVTIAK
IDATANDVPDPITGFPTIRLYPAGAKDSPIEYSGSRTVEDLANFVKENGKHNIDAFDVSP
REAQEGGDVTDASPSATQTETPAATEDETVEHDEL
Download sequence
Identical sequences A0A1R3R8E3
jgi|Aspca1|19511|fgenesh1_pm.00082_#_119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]