SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Aspca1|20686|fgenesh1_pm.00118_#_84 from Aspergillus carbonarius ITEM 5010

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspca1|20686|fgenesh1_pm.00118_#_84
Domain Number 1 Region: 228-331
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000439
Family UBX domain 0.03
Further Details:      
 
Domain Number 2 Region: 2-106
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000649
Family Thioltransferase 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspca1|20686|fgenesh1_pm.00118_#_84
Sequence length 439
Sequence
MFYEGSLQDGIASAVAESKAVVCFVRDDEQTSTQWEEEYFTFDEDLSRLLDTKAVLLRLT
QGTPEAGFLASFCPLVKFPTVVVIKNGMMCDYLVPDLSKEDFRVRLAAKLDESAPAQQDI
GGQAGDATAAQTTDASVPAPVSSPAPVSPPVPGPAPVSAPAAPTPPVAAPTPSQPEPQPS
PPTEPVQPRDASIREGKRRVEDARTLQPQSPPSKKLQQQKQTPTPKQSPKPATKPKEKPS
APISTPRQPSIPNQYRLQVRLFDGRSVRSSFTPTQTIRADIRPWLDSQMDEKSPYNLKHI
LTPLPNRTLTLTDEETPLAELGLGSSANLVMIPIQSYTEAYSATASSLPVRAVSSAYGLV
SSAVGTATGLVGSFFGYGPTPAAETEQPAPTPAPASNGRRPRTGPIIRTLRDQQNERDDR
AFYNGNQLNFQPRNDGDRR
Download sequence
Identical sequences jgi|Aspca1|20686|fgenesh1_pm.00118_#_84

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]