SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Aspca1|26937|fgenesh1_pm.00866_#_662 from Aspergillus carbonarius ITEM 5010

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspca1|26937|fgenesh1_pm.00866_#_662
Domain Number 1 Region: 28-109
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000196
Family Glutathione S-transferase (GST), N-terminal domain 0.014
Further Details:      
 
Domain Number 2 Region: 195-264
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.0000000895
Family Glutathione S-transferase (GST), C-terminal domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspca1|26937|fgenesh1_pm.00866_#_662
Sequence length 279
Sequence
MATNTTTTTTITYYDIAMRPPRERTCCSPNPWKSRLALNFKNLSYTTIWVPLPDVSKVRR
SLDLPACRKFADGTDFYTLPILIDANTNSKIGDSFDIAVYLQKHYPTSGAGDLLPPQPLD
FVLRQEFTSLVPLSERTEGEFDEYARFNTNVDAVFTAHVGLAVQGMPLDPATAEATKAEF
VRRAGVSSFDDFVLQGEAREKVMGSFRETLGDLAKVFLKDRSGPFVLGKKASYADCIVGG
WLRMMYVALPGSEWEELRSWHGGVFGRLHDALDEFAEVK
Download sequence
Identical sequences A0A1R3S027
jgi|Aspca1|26937|fgenesh1_pm.00866_#_662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]