SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Aspca1|27438|fgenesh1_pg.00009_#_249 from Aspergillus carbonarius ITEM 5010

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspca1|27438|fgenesh1_pg.00009_#_249
Domain Number 1 Region: 100-222
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 5.64e-17
Family Glutathione S-transferase (GST), C-terminal domain 0.00092
Further Details:      
 
Domain Number 2 Region: 7-96
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.17e-16
Family Glutathione S-transferase (GST), N-terminal domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspca1|27438|fgenesh1_pg.00009_#_249
Sequence length 231
Sequence
MESQDIFELYTYWCSSCCQRIIIAAHLKDIPLQFKYIDMGTRAHHEQKYKDELNPSASIP
TLVVHHPGGEKTIIRQSMTILEYFDERFPDRSPLLPPVSAWQDRIKVRDLVNIIAIDVQP
PTNSRIAKRVRAVQDNVQDQIAFVRQAFTDGLQAYEALISPSSKYSFGEQVTMADVVLVP
TVDQALMYKMTLDFAPNVLRVYNSLKELEAFKAGDGKNQGDTPEQFRSTSQ
Download sequence
Identical sequences A0A1R3RNA6
jgi|Aspca1|27438|fgenesh1_pg.00009_#_249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]