SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Aspca1|27525|fgenesh1_pg.00009_#_336 from Aspergillus carbonarius ITEM 5010

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspca1|27525|fgenesh1_pg.00009_#_336
Domain Number 1 Region: 5-296
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.6e-40
Family FAD-linked reductases, N-terminal domain 0.00045
Further Details:      
 
Domain Number 2 Region: 334-432
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000181
Family Glutathione peroxidase-like 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspca1|27525|fgenesh1_pg.00009_#_336
Sequence length 452
Sequence
MAECYDIVIVGAGPVGLMLSACLLRLGPYKIKHIDQRPGPTETGRASGIQGRTLDVLQNL
DLKRAIMSYNPGLIYEVAFWDVSKDGPGIRRTGMAKSYPDYIDTRHPFSTIIHQGRIEKL
FLDDLRERGIAIERTWTIAGFRRNPCGEDPGHPLVVDLVSIDGTKKSTIRTKYLFGADGA
RSRVRDLLRVPMLSKDPTIHVWSVIDGVVKSDFPDIQVHVLLGSVEAYHTHSPKAGQGMT
YGFLDAHNLAWNLHRVEAGFLRRSLLKTYEGERKLVAAKLIEFDATYANLFSSHQPVSGN
SFAPNSEFVQAFKQNSLLTSGYGVEYPVNSLTWPSTTSTNTTALRPGRSLPTATVTRVID
AHPVYLEQEIPFNGSYRIYIFAGNPVTTSQAHHVDADDRDSLPVAETADSNAHLKMGFDT
DTGGIVVVRPDGKQEPEGCPVTQHQGSRTIFV
Download sequence
Identical sequences jgi|Aspca1|27525|fgenesh1_pg.00009_#_336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]