SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Aspca1|28736|fgenesh1_pg.00083_#_339 from Aspergillus carbonarius ITEM 5010

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspca1|28736|fgenesh1_pg.00083_#_339
Domain Number 1 Region: 6-199,294-382
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.92e-47
Family FAD-linked reductases, N-terminal domain 0.0014
Further Details:      
 
Domain Number 2 Region: 422-576
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.26e-20
Family Glutathione peroxidase-like 0.0028
Further Details:      
 
Domain Number 3 Region: 202-300
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.59e-17
Family PHBH-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspca1|28736|fgenesh1_pg.00083_#_339
Sequence length 577
Sequence
MADIIKTDVLICGGGPVGLLVAYGLARQGVDSVLIEQHDKSQQAMYGRATTLYPRTLEML
DQLGLLDDLNQIGYIARNSVTYKGNRRVTSRGWHVMFQRMHGTYLDYCLNIRQKYSEEVI
RDAYEVLRGNPYIGWKLDSFSVEEGSYENDYKVTSQITEVLHHCPPRGKGFLVLTFLNSK
YIVGADGGHSLVRRLAGIPFEGGHTDFKWVRIDGRFKTDMPDSDVGFASIESKSHGNVLW
VQLDHGVKRIGFAMTQEMLAKYGDKLTLEDAKNEAIKAMEPFSMEIESIEWWTLYGINQR
VADSFFNNDRVLLAGDACHTHSSGAAQGMNTGVHDAINLAWKLGGVAKGWYGDDMLRTYD
SERRPAAQHLISLDKAFSATISGSVPDGYKDLSLDANELFTKIFDDTIQFNIGLGIHYNE
NLINKDPVATMVSAGWRAPDALVYAPGSRLPTRLFHLTQNTGVWSVIVFAGRPDKTKDSL
TRGVEVLKQLNETLPRGMLRFLTVVSQSPAGGDQVFDIPKIGRLYYDSERSAHTAYTISD
ANGAIVIVRPDGILGYATHLEDTSSIPGYFMGFVTPR
Download sequence
Identical sequences jgi|Aspca1|28736|fgenesh1_pg.00083_#_339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]