SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Aspca1|29951|fgenesh1_pg.00118_#_435 from Aspergillus carbonarius ITEM 5010

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspca1|29951|fgenesh1_pg.00118_#_435
Domain Number 1 Region: 258-431,484-551
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.26e-24
Family Protein kinases, catalytic subunit 0.068
Further Details:      
 
Domain Number 2 Region: 6-86
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.56e-18
Family Glutathione S-transferase (GST), N-terminal domain 0.001
Further Details:      
 
Domain Number 3 Region: 77-183
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.0000000000000298
Family Glutathione S-transferase (GST), C-terminal domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspca1|29951|fgenesh1_pg.00118_#_435
Sequence length 743
Sequence
MASSILPLTLYGKGGPNPPRVAIILNELSIPYTTIPIPLSTVKQPSYTAINPNGRLPALH
DPNTNLTIWESGAIVHYLISRYDKSHKISFPEGTNESYLTAQWMFFQASGQGPYYGQASW
FKKFHPERVSSAVERYVGEIRRVTGVLERVLKERMQNGEEEPWLVGGKCSVADLVWISWQ
VIVTRVITKEDGFFDDSGTPLYDRTNDAPGHDRPRLTRWKHLPSPSSSPIKRKPIQHEQL
FTYTNGRFLVNEKLKLSKRYAKFDLDALCAVVSSLPQISSPIATIDKMEGGFNKALLMTA
ENGKQVIAKMAFPNLVPAKYVTASEVAVLEYVGSYTSVPVPKVIGWSSDSSNPVGSEYIL
MEKASGKQLFQVWGEMNQLQQFSLIKSLVQLESQLAAMQFPAYGSLYLWDSVSQLDSVVP
IDDKYCLGPMYNASWFPQLGTELYAGPWKDLSELGPALTGRGLVRLQHSTLTPRGPHFGT
LSEHREILEATKKILPSLAGLPAIQKLFTPTIWHSDLHMGNIYVSEEDPTTIVSIIDWQF
ISIMPAFMQVQWPTFLSPPETYDYGLVKPELPANFDGMDEDEKAFARTERDQAFLSKCYE
AGLAKYHFPLYLALTQIYSPVRHLFSFCENTTKNGIVPLRDSLTEIINNWTELGLTDTCP
FRIHDYDLSKHQDEVARYKDWQTLKGYTQELLHTDDDGWISPQLDFDKVRARHDELFQLY
MQRETEDLSESEAKRLWFYTDNT
Download sequence
Identical sequences jgi|Aspca1|29951|fgenesh1_pg.00118_#_435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]