SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Aspca1|32952|fgenesh1_pg.00609_#_593 from Aspergillus carbonarius ITEM 5010

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspca1|32952|fgenesh1_pg.00609_#_593
Domain Number 1 Region: 42-147
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.67e-31
Family Thioltransferase 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspca1|32952|fgenesh1_pg.00609_#_593
Sequence length 152
Sequence
MFSRSLASSAFRPFCRQPQVLQPRFTGLQLPSIFHTRNLSSETRTAIDKAIASAPVVLFM
KGTPETPQCGFSRASIQILGLQGVDPKKFVAFNVLEDSELRQGIKEYSDWPTIPQLYLDK
EFIGGCDILMSMHQNGDLAKLLEEKEVLVAAD
Download sequence
Identical sequences A0A1R3RT48
jgi|Aspca1|32952|fgenesh1_pg.00609_#_593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]