SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Aspca1|34252|fgenesh1_pg.00772_#_28 from Aspergillus carbonarius ITEM 5010

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspca1|34252|fgenesh1_pg.00772_#_28
Domain Number 1 Region: 7-228
Classification Level Classification E-value
Superfamily HAD-like 5.51e-34
Family HAD-related 0.0093
Further Details:      
 
Domain Number 2 Region: 489-607
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 4.04e-25
Family Glutathione S-transferase (GST), C-terminal domain 0.0065
Further Details:      
 
Domain Number 3 Region: 357-414,441-476
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000716
Family Thioltransferase 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspca1|34252|fgenesh1_pg.00772_#_28
Sequence length 658
Sequence
MSISPLPKVLFFDVFGTVVEWRDCVTRALMRAAESALLDPEKQLSVDVRVQAGAMTPEDW
QAIAEEWRASYGQFTASFEPSSAFVSVDEHHYTYIHKLLQQRGLDDMLTDKERWDLALCW
HRLEPWSDTVEGLRLLNRQLRTCTLSNGNVALLEDLRNYGSLPFTDMASAEHFGAYKPSP
QVYQGAVKRFGLDPSECGMVAAHLYDLKAAKALGFMTIYIERPQEENLTAEQIAEARREG
FVDQWFSLGCGGLQELICHDLRHLYFFPCATLPLYHVILLPDPRNSAPPAGVVSICQRPV
TLTWRNIMLNQPRLPTFVENRQKQGKLRSQESQVHRHADADGHFRRKDSAFRSFISGDLN
AEFPAEKDRYVLYLNYGCPWAHRTNLVRSLKGLEDIIQLVVLDPELGPEGWFFSGRYGSA
EKDPLYGFTKLSQFYLRADPTYEGRYTVPMLWDKKRATIVNNESSELIRMFYTGFDDLLP
EELREVNRPDGGFYPAHLRSEIDAMNEWVYHKINNGVYKTGFATTQEAYDENVYPLFEAL
DRVERHLAQPGHQPYLFGENITEADIRLYTTICRFDVAYYLIFRCNLKMIRHSYPLIDRW
YRRLYYDETQRTRGGAFKKTTFFEIYKFNYQKALGKRSGSTQTIIPAGPSPDILPLEA
Download sequence
Identical sequences jgi|Aspca1|34252|fgenesh1_pg.00772_#_28

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]