SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Aspca1|34720|fgenesh1_pg.00815_#_70 from Aspergillus carbonarius ITEM 5010

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspca1|34720|fgenesh1_pg.00815_#_70
Domain Number 1 Region: 522-1024
Classification Level Classification E-value
Superfamily Activating enzymes of the ubiquitin-like proteins 1.77e-139
Family Ubiquitin activating enzymes (UBA) 0.00067
Further Details:      
 
Domain Number 2 Region: 128-513
Classification Level Classification E-value
Superfamily Activating enzymes of the ubiquitin-like proteins 7.46e-104
Family Ubiquitin activating enzymes (UBA) 0.0051
Further Details:      
 
Domain Number 3 Region: 1397-1540
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 6.68e-29
Family Glutathione S-transferase (GST), C-terminal domain 0.032
Further Details:      
 
Domain Number 4 Region: 1260-1322,1355-1391
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.16e-16
Family Glutathione S-transferase (GST), N-terminal domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspca1|34720|fgenesh1_pg.00815_#_70
Sequence length 1567
Sequence
MFVLLSKPLLTRGLFTSGLKRLDEEYRLSVPSITSPTSGRLRVPHRSYPSFLSLHQEYTA
RKSCSQRQGFRSQVFTIPTEIPVRDAAKLGKRRASADNKAPPEKKIMTDAMMQVDNPQET
VEAIKHGEIDESLYSRQLYVLGHEAMKRMGSSNVLVVGLKGLGVEIAKNIALAGVKSLTL
YDPAPVAISDLSSQFFLQPQDVGKPRAEVTAPRVAELNSYVPVTVHEGSNLADNLEDLKR
YQAVVLTLTPLKEQLAIADFCHKNGIYLTITDTFGLFGYLFNDFGKNFTVGDATGEEAVS
GIVAAIDESGLVSALDETRHGLEDGDFVTFSEVKGMDGLNGCAPRKITVKGPYTFSIGDV
SDLGTYESGGIFSQVKMPKFMDFAPLDEQIKKPEFIISDFAKFDRPAQLHIGVQALHKFA
EAHGGDLPRPHNDSDAQEVLKIATELASTLEDKVELDEKLLKELSYQARGDLNPLAALFG
GIAAQEVLKAVSGKFNPVHQWLYFDSLESLPTSITRSEEACKPLGSRYDGQIAVFGKEFQ
DKIANITQFLVGSGAIGCETLKNWAMMGLGTGVKGKIIVTDMDQIEKSNLNRQFLFRSRD
VGKLKSECASAAVEAMNPELKGKIVTLRDRVGPDTEHVFNEEFWQGLDGVTNALDNVDAR
TYVDRRCVFFRKPLLESGTLGTKGNTQVVLPHITESYSSSQDPPEKTFPMCTLKSFPNRI
EHTIAWARDLFQTYFVGPPEAVNMYLSQPNYIEQTLKQAGNEKQTLEHLRDFLVTDKPLT
FDDCIVWARQQFEAQYNNAIQQLLYNFPRDSKTSSGQLFWSGPKRAPTPLKFDSSNPTHL
SFIVAGANLHAFNYGIKNPGADKGYYRKVVDNMIIPEFTPKSGVKIQANENDPDPNAQAS
SSSFDDSQAIQRLVESLPSPKDLAGFRLSPVEFEKDDDTNHHIDFITAASNLRADNYDIP
QADRHKTKFIAGKIIPAIATTTALVTGLVALELFKIIDGKDDIEQYKNGFVNLALPFLGF
SEPIASPKGKYMGKTGEVTIDQIWDRFEVADIPLQDFLKHFADLGLEISMVSSGVSLLYA
SFYPPSKVKDRLPMKMSKLVEHISKKPVPEHQKNIIFEVTAEDQTEEDVEIPYVMSRPRS
NAITPFPLSNPTSSIVLLFSRVDRGVASVGVLSKGFVSAAITKPLLTHPSPSNPTGLAIP
LAAQNRCHPPTSRPLQKLHPPRTTHPLFKAHHGGNTSKITDWVNPNDKSGEFKRQVSVFR
NWISREPGAEFPPEKGRYHLYVSYACPWAHRTLITRQLKGLEDIISFTSVHWHLGEKGWR
FATAEEQQPSENVTSDPLHSDFTHLRDIYFSNAPDYTGRFTVPVLFDKKTNRIVSNESSE
IIRMLYYEFDDLLPTPYKNLDLFPPSLRASIDATNDWTYNDVNNGVYKSGFATTQEAYEK
AVATLFSSLDRIEAHLAETAAKGPFYFGSEITEIDIRLFTTMIRFDPVYVQHFKCNIRDI
RSGYPAIHRWMRALYWDVPAFKDTTNFEHIKKHYTKSHKQINQFGITPVGPVPDVLPKGE
EVRAVGV
Download sequence
Identical sequences jgi|Aspca1|34720|fgenesh1_pg.00815_#_70

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]