SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Aspca1|34771|fgenesh1_pg.00815_#_121 from Aspergillus carbonarius ITEM 5010

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspca1|34771|fgenesh1_pg.00815_#_121
Domain Number 1 Region: 2-90
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000587
Family Thioltransferase 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspca1|34771|fgenesh1_pg.00815_#_121
Sequence length 319
Sequence
MSDPTLYLYTSLTAGSSHIVTATARLETILKANKLPFRAIDVATDEVARKLWGRRSKGKK
LPGLVKFGTVVGDLEQVEEWNEYGELRMQINSVEDYDSIPASSTTTAQPETPSATSTPTP
ETATLKQSTIKIQSPPSKETPKDSSIAVAMRQASEEAAARAKGNSSQPPAAKEPIPAVTE
KKETPAADEQSQTGKEDTVRGKTASPGTQDSKPKRPPLVPEVAAESSANFHADAAEALGL
VQHHRGSIISATSKEEQEKVAQDLRKSISGGQQDLLQSLREDHAARTEQEETIEEESDGG
EEQDGTPSRKDAQDVHVSG
Download sequence
Identical sequences jgi|Aspca1|34771|fgenesh1_pg.00815_#_121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]