SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Aspca1|35549|fgenesh1_pg.00866_#_356 from Aspergillus carbonarius ITEM 5010

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspca1|35549|fgenesh1_pg.00866_#_356
Domain Number 1 Region: 93-210
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 5.73e-34
Family Glutathione S-transferase (GST), C-terminal domain 0.00066
Further Details:      
 
Domain Number 2 Region: 4-89
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.68e-22
Family Glutathione S-transferase (GST), N-terminal domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspca1|35549|fgenesh1_pg.00866_#_356
Sequence length 250
Sequence
MSSPDITLYTAQTPNGIKISIALEELGLPYKVEKIDISKNTQKEPWFLEINPNGRIPAIT
DTFTDGQKIRIFESGSILTYLVEQYDKDHKISYPRGTREYYEVNSWLYFQNAGVGPMQGQ
ANHFSRYAPERVEYGINRYVNETRRLYSVLDKHLSTSKSGYLVGDHVSIADISHWGWVAS
AGWAGVDIEEFPHLKAWEERMAAREGVEKGRHVPSPHTIKELIKDKAAAEKLAAESRTWI
QQGMKADAKH
Download sequence
Identical sequences A0A1R3RZ35
jgi|Aspca1|35549|fgenesh1_pg.00866_#_356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]