SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Aspca1|10474|e_gw1.00042.110.1 from Aspergillus carbonarius ITEM 5010

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspca1|10474|e_gw1.00042.110.1
Domain Number 1 Region: 4-187,280-372
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.73e-56
Family FAD-linked reductases, N-terminal domain 0.0000209
Further Details:      
 
Domain Number 2 Region: 404-590
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.91e-55
Family Glutathione peroxidase-like 0.00015
Further Details:      
 
Domain Number 3 Region: 190-286
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.86e-26
Family PHBH-like 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspca1|10474|e_gw1.00042.110.1
Sequence length 600
Sequence
MPEKVDVLICGSGSAGLCAATWLARHGIPCKILERRDGPMTMGQADGVQCRTVEIFESFG
VGEELLRESYHVLEVVFWADDGSGVIRRTGKTADTQPGLSHQPHVILNQARINMLLIELM
RKFNNQEIDYGYTVKDVKVDSQLSGDPEAYPVKVTAEKDGKVERFEAKYALACDGAHSIV
RKALGYNMVGDSTDAVWGVMDMVPRTDFPDIRKKTTIRSKAGNLLIIPREGESYSLTRFY
IELPTGTKAKDVRLDDLQSVAKNILSQYQIEFVETVWWSAYAIGQRHADFFHKDYRVFLA
GDACHTHSPKAGQGMNVSLQDGYNVGWKLASVLKGLAHPSLLETYVLERQKVAIDLINFD
RSFAKLFSSQGDASPQEFQEGFIKSGKYTAGLTAKYDESPITSDTGLSKELATNVVIGMR
LPSAQVVRFCDSKPMQLAASLKSDGRWRVIAFVGDLRLSQNMVALKALGDYLGSDESPLQ
MFRLQGGDPDSLIEPVMVGYGKRDGVELAQVPKCFYPITGRHHIRDLHKIFFDDESYNRG
HGHVYEHLGIRPDQGAVVIVRPDQYVSAVFSLDGYRRIGSFFEGFMTPQKRPEPLAGSRL
Download sequence
Identical sequences A0A1R3RLJ2
jgi|Aspca1|10474|e_gw1.00042.110.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]