SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Aspca1|11322|e_gw1.00083.226.1 from Aspergillus carbonarius ITEM 5010

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspca1|11322|e_gw1.00083.226.1
Domain Number 1 Region: 18-173,207-231,328-417
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.8e-49
Family FAD-linked reductases, N-terminal domain 0.0001
Further Details:      
 
Domain Number 2 Region: 466-645
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.68e-48
Family Glutathione peroxidase-like 0.0000904
Further Details:      
 
Domain Number 3 Region: 234-334
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.61e-27
Family PHBH-like 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspca1|11322|e_gw1.00083.226.1
Sequence length 652
Sequence
MCKSSVSDCPLLLTISSLIIGAGPSGLAVAYWMAQYGINARIIDKRGTKLFRGHADGLRS
RTLELFDSMGFAHRVTEEGYHAAAFMFWRPDGHGGLQRTGQQRSTIHDSSPYRMALLTQG
RIERFFLDVIRGTSSLDVERGVVGESLSYDESLEKDPQAYPITVQLRTLSEEEATPAPNP
GICPYQPAPDDREDLIQKRKHKVGTVETIRAKYLIGCDGAHSWTRKQLDIPFEGSHTDHI
WGVMDVVPITDFPDIRWPSSIDGPHGHLLMITREGNMVRFYVPLQEDDEVVADSFDRSAV
TLDMLRERVKKIMAPFYFDFKICHWWAAYQVGRRLTPTVNKGRMYLVGDAVHTHSPKIGL
GMNMSIQDGFNLGWKLGLVLKGIASPTILETYASERHQLAQMVLDFDKKWASFFLRKEKQ
VKQELEASPEEPDDIQAAMREAFIENELFAEGHVTFYKSSPLVHKGSTAMAKNLVAGERF
PAALIRNQADGQPWWTTRLLKSDGRFRILLLAGDVRLQDRQSCMSTLSKSLTELLKRFTP
SEQKPDSVIEVKAIHSAPLDQVELRDFPPVVRQFDEDEGWDYTKVWSDSECFWDQQCKGN
AYEIWGVDRSRGAMVVLRPDQYVGWMGELDDVAGVTEYFEGILCENKPSPVL
Download sequence
Identical sequences A0A1R3S1W3
jgi|Aspca1|11322|e_gw1.00083.226.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]