SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Aspca1|12091|e_gw1.00118.582.1 from Aspergillus carbonarius ITEM 5010

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspca1|12091|e_gw1.00118.582.1
Domain Number 1 Region: 55-265
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.97e-71
Family Glutathione peroxidase-like 0.00000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspca1|12091|e_gw1.00118.582.1
Sequence length 266
Sequence
MASIIPRAGFRALTALPRATPLPRVSFSQLPRALPRLQPLSRRFLATIPQEQPRLRLGST
APNFKATTTHGEIDFHEFIGNSWAILFSHPADFTPVCTTELGAFAKLKDEFEKRGVKMIG
LSANDLGSHDKWIDDINEVANTNVQFPIIADADRKVAFLYDMVDQRDLDNIAEKGIPFTI
RSVFIIDPEKKIRLTMLYPASTGRNSAEVLRVIDSLQTADRKGVATPINWNVGEDVIVPP
SVSTEDAKKKFGEVRELKPYLRYTKY
Download sequence
Identical sequences A0A1R3RWE5
jgi|Aspca1|12091|e_gw1.00118.582.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]