SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Aspca1|16519|e_gw1.00771.414.1 from Aspergillus carbonarius ITEM 5010

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspca1|16519|e_gw1.00771.414.1
Domain Number 1 Region: 3-81
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.98e-22
Family Glutathione S-transferase (GST), N-terminal domain 0.0084
Further Details:      
 
Domain Number 2 Region: 86-223
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 9.76e-16
Family Glutathione S-transferase (GST), C-terminal domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspca1|16519|e_gw1.00771.414.1
Sequence length 238
Sequence
MSAPKIILYTNRVCPWAHRAHIVLQELGLPFEEVTIDLDTPREPWYLEVNPRGLVPSLSY
NNEIITESGIVAQFLADAHPSHLVPPSNTPEGALQRARIAFFVDTYSSKVSPHYNTALRG
VTVEERKAAGEALVAAIKKEIEPLLYPGLEGKTHGPFFGGSEKLTLVEVLLGSFLIRLHA
FAKEEYDLLDAGLSQSLAEVKNFSRWAEATREHPSVKTIFPEKAAAAKTKSKLASVRK
Download sequence
Identical sequences A0A1R3RKE4
jgi|Aspca1|16519|e_gw1.00771.414.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]