SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Aspca1|17205|e_gw1.00855.56.1 from Aspergillus carbonarius ITEM 5010

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspca1|17205|e_gw1.00855.56.1
Domain Number 1 Region: 8-211,296-389
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.91e-47
Family FAD-linked reductases, N-terminal domain 0.00016
Further Details:      
 
Domain Number 2 Region: 424-604
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.68e-40
Family Glutathione peroxidase-like 0.00055
Further Details:      
 
Domain Number 3 Region: 218-312
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.14e-26
Family PHBH-like 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspca1|17205|e_gw1.00855.56.1
Sequence length 605
Sequence
MPPTVATTDLLIIGAGPAGLMAACWASQYPNMTTRIIDKRPGRTPTGHADGLQSRSLEIL
ESYGMVDAILQKGVQHAEMCYWGRNKCTGGIERQKRSRARMGDGERYHMVLLNQGLVEQT
FLDSLRGKGVVKVEYGVRAETLVLKGEEEDEYPVEVGVRRVGADGMAMLESFTVADSLIV
GAGDDWEVIRARYIIGCDGAHSWTREQLKVPVRVCSGDSTWGVVDIVPISDFPDIRQSCA
IHSGENGSIMTAPRENRLVRFYTYPKGDGKLNVEGRDQSDVSLDDLVESIRNAMRPYQLT
YKHCDWWSIYKILINYRVFLAGDAAHTHSPKAGQGMNVSMQDTYNLVWKLGSVIAGAAAP
SILDTYDLERWPVGEELLRLDTELVEAYEQDVTSTEGVERVRGKYVDFMTGMGIAYGPSA
LISGNSSDPSVARNMKVGMRLASYPVVAQADGVCSQLAGRFASNGAWRLLVFPGDLRQSH
TQSSLESFADKFNKQPHLSRWQKTPGLGRCYPLETILVHSSPRTSINLLDLPDTFHPFDE
AWGRDYSRVFSDDGSDGGDLGHVYDGYGIQEMGCLVLCRPDQHVAWIGSLEEVEALEEFF
ARISP
Download sequence
Identical sequences jgi|Aspca1|17205|e_gw1.00855.56.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]