SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Aspca1|19169|fgenesh1_pm.00042_#_231 from Aspergillus carbonarius ITEM 5010

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspca1|19169|fgenesh1_pm.00042_#_231
Domain Number 1 Region: 396-506
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.17e-16
Family UBX domain 0.021
Further Details:      
 
Domain Number 2 Region: 173-320
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000917
Family PDI-like 0.063
Further Details:      
 
Domain Number 3 Region: 12-56
Classification Level Classification E-value
Superfamily UBA-like 0.00000014
Family TAP-C domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspca1|19169|fgenesh1_pm.00042_#_231
Sequence length 512
Sequence
MSSSGLDISELSDSERSALETYIAVTGQEHSEAIPLLRRSQWNVQIAISKFFDGEGPDPV
EEARAALNTPPPRPSRQTQNLMSDDLAAQFSPNHRAAEPAPRISTQPEDQSVYRPPFLLA
LLFTPLNLLYRLLYSSFRLFGTLFPFLPRLLNRTASPALQGSQRNTNGRRTLGPKDTASR
FIREFEEEYGTNSIGFLENGYNMALEKAHRDLKFLLVVLLAPEHDDTNGWVRDTLLSREV
VDFVNDQQNDVLVWGGNIQDSEAYQVANSLRCTKFPFAAAIVHTPSVSSTAMSVVSRISG
TTSPAEFVEKLRSAITQHKEPLERIRATRAEQQASRSLREQQDSAYERSLAIDRERARQR
REEEAARQREEQEAAERRAAEEKRIHDLAQWKQWRAQSIADEPGLDVKDAVRISIRLPSG
ERVIRKFAPEAPIDELYAFVECYDILKEPTEKAGEVMKPEGFEHQYGFRLVSPMPRVVYE
VDAGGSVRDKIGRGGNLLVEPIDDESDEEDEE
Download sequence
Identical sequences A0A1R3RLL7
jgi|Aspca1|19169|fgenesh1_pm.00042_#_231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]